Love, Blood and Wilderness | YELLOWJACKETS
wandamaximilfff
  • Reads 80,626
  • Votes 3,384
  • Parts 56
  • Time 11h 44m
  • Reads 80,626
  • Votes 3,384
  • Parts 56
  • Time 11h 44m
wandamaximilfff
Ongoing, First published Nov 29, 2023
Mature
2 new parts
benscottcourtneyeatonellapurnellfanfictionjackietaylorjasminesavoybrownlauraleelesbianromancelivhewsonlottiematthewslottiematthewsxocmistyquigleynataliescatorrcionataliescatorrcioxocoriginalcharactershaunashipmanshaunashipmanxocsophienelissesophiethatchertaissaturnerthewildernessvanpalmerwlwyellowjacketsyellowjacketsfanfic
Though the wilderness is dangerous and death seems scary, love just might be the worst of them all.

yellowjackets season 1-?
lottie matthews x fem oc
natalie scatorrcio x fem oc
shauna shipman x fem oc
@wandamaximilfff


story for if you love characters who made horrible decisions and and love squares
Public Domain
benscottcourtneyeatonellapurnellfanfictionjackietaylorjasminesavoybrownlauraleelesbianromancelivhewsonlottiematthewslottiematthewsxocmistyquigleynataliescatorrcionataliescatorrcioxocoriginalcharactershaunashipmanshaunashipmanxocsophienelissesophiethatchertaissaturnerthewildernessvanpalmerwlwyellowjacketsyellowjacketsfanfic
Table of contents

56 parts

Sign up to add Love, Blood and Wilderness | YELLOWJACKETS to your library and receive updates
or
Content Guidelines
You may also like
Marionette || YellowJackets by InkFont
20 parts Ongoing Mature
Une Marionette sur une corde
Getaway Car, Yellowjackets - ON HOLD - by sqattorodicos
16 parts Ongoing Mature
GETAWAY CAR- You were drivin' the getaway car We were flyin', but we'd never get far Don't pretend it's such a mystery Think about the place where you first met me Josette Taylor had a good life. key word was, had. Now she had to cover up every horrible thing she did that she wasn't pround of. 2023, april 18th. lottie Matthews x fem!oc + Jackie Taylor x fem!oc yellowjackets ♱
Nightmares -Yellowjackets by -LadyKidd-
43 parts Ongoing Mature
In 1996, a high school girls' soccer team flies to Seattle for a national tournament. However, the plane crashes in Ontario, and the survivors are left to fend for themselves for nineteen months. fem oc 𝒙 Natalie Scatorccio [yellowjackets: s1- ] {English is not my first language, I apologize for any grammatical errors}
𝙬𝙞𝙡𝙙𝙛𝙡𝙤𝙬𝙚𝙧 - yellowjackets by norainbowsforgracie
8 parts Ongoing Mature
❛you say no one knows you so well,❜ 𔓘 Being stranded in the wilderness is definitely a challenge of its own. Now, being stranded in the wilderness while torn between two girls? That was the impossible task. 𔓘 ❛but everytime you touch me, I just wonder how she felt.❜ 「Yellowjackets s1 - ? Natalie Scatorccio×Fem!oc Lottie Matthews×Fem!oc」
Exanimate by missperegrinesfav
5 parts Ongoing Mature
showing no sign of life; lifeless.
𝐍𝐄𝐔𝐑𝐎𝐒𝐈𝐒. | yellowjackets by lucwritess
37 parts Ongoing Mature
𝐍𝐄𝐔𝐑𝐎𝐒𝐈𝐒. ❦ 𝐘𝐄𝐋𝐋𝐎𝐖𝐉𝐀𝐂𝐊𝐄𝐓𝐒 ❝ 𝘵𝘩𝘪𝘯𝘬𝘪𝘯𝘨 𝘰𝘧 𝘺𝘰𝘶, 𝘪𝘴 𝘢 𝘱𝘰𝘪𝘴𝘰𝘯 𝘪 𝘥𝘳𝘪𝘯𝘬 𝘰𝘧𝘵𝘦𝘯 ❞ [ yellowjackets s1- ] [ fem oc 𝒙 lottie matthews ] @𝐥𝐮𝐜𝐜𝐰𝐫𝐢𝐭𝐞𝐬
CASUAL ﹙ yellowjackets ﹚ by shpsman
30 parts Ongoing Mature
𝐂𝐀𝐒𝐔𝐀𝐋 | "I hate that I let this drag on so long, now I hate myself" ﹙ i talk to god but the sky is empty ﹚ Season 1 - Season 2 Multiple Love Interests x Female!Oc
CHERRY BOMB ~ yellow jackets (van palmer) by ginnyoxox
31 parts Ongoing Mature
thanatophobia ~ the fear of losing someone you love. cheryl stevens COULD have been a champion, aswell as the other girls on on her team she had a future. that all changed in the summer of '96. the girls soccer team was set to go to nationals, in just a few hours that all changed.. ----------- van palmer x fem!oc 👩‍❤️‍💋‍👩 i do not in anyway own yellow jackets or it's characters Cheryl steven's is an original creation of mine so is her storyline! created: wednesday 3rd april 2024 ended: ?? no.4 in #vanpalmer no.22 in #wilderness
SONDER | yellowjackets by ilyieuwdm
43 parts Ongoing Mature
"I can't keep pretending. I love you, more than I've ever loved anyone. And it terrifies me, but it's the truth. I need you to know." [yellowjackets s1-] [shauna shipman x oc] [lottie matthews x oc] [natalie scatorccio x oc]
STRANGERS ♱ yellowjackets by adelinethevampire
52 parts Ongoing
AM I MAKING YOU FEEL SICK ? Susann-Rose Hopper hated Natalie for stealing her brother away from her. To Natalie Scatorccio, Susann-Rose "Bunny" was only her best friend's perfect, angelic, over-achieving, and slightly neurotic twin sister who drove her insane. The bittersweet hatred and love the two carry for each other suddenly becomes the only familiar thing in the strange heart of the wilderness. Natalie Scatorccio x fem oc Yellowjackets season 1-2 1# Natalie Scatorccio 1# Yellowjackets 1# Lottie Matthews 2# Showtime 1# Ethel Cain
You may also like
Slide 1 of 10
Marionette || YellowJackets cover
Getaway Car, Yellowjackets - ON HOLD - cover
Nightmares -Yellowjackets cover
𝙬𝙞𝙡𝙙𝙛𝙡𝙤𝙬𝙚𝙧 - yellowjackets cover
Exanimate cover
𝐍𝐄𝐔𝐑𝐎𝐒𝐈𝐒. | yellowjackets cover
CASUAL ﹙ yellowjackets ﹚ cover
CHERRY BOMB ~ yellow jackets (van palmer) cover
SONDER | yellowjackets cover
STRANGERS ♱ yellowjackets cover

Marionette || YellowJackets

20 parts Ongoing Mature

Une Marionette sur une corde

More details