•  
    • Browse
    • Paid Stories
    • Editor's Picks
    • The Wattys
    • Adventure
    • Contemporary Lit
    • Diverse Lit
    • Fanfiction
    • Fantasy
    • Historical Fiction
    • Horror
    • Humor
    • LGBTQ+
    • Mystery
    • New Adult
    • Non-Fiction
    • Paranormal
    • Poetry
    • Romance
    • Science Fiction
    • Short Story
    • Teen Fiction
    • Thriller
    • Werewolf
    • Wattpad Picks
    • Editors' Choice
    • From our Stars
    • Wattpad Studios Hits
    • Self-care level unlocked.
    • 💕Love is in the spring air🌺
    • Community Curator: @KateLorraine
    • The Watty Awards
    • Community Happenings
    • Wattpad Ambassadors
      • Create a new storyCreate a new story
      • My Stories
      • Helpful writer resources
      • Wattpad programs & opportunities
      • Writing contests
    Try Premium
    Log in Sign Up
    Love Bites (Crescent City Werewolves: The Short Stories)
    Love Bites (Crescent City Werewolve...
    JulieMidnight
    • Reads
      Reads 35,364
      35,36435.3K
    • Votes
      Votes 2,154
      2,1542.1K
    • Parts
      Parts 12
      1212
    • Time
      Time 3h 11m
      3 hours, 11 minutes3h 11m
    Start reading
    • Reads
      Reads 35,364
      35,36435.3K
    • Votes
      Votes 2,154
      2,1542.1K
    • Parts
      Parts 12
      1212
    • Time
      Time 3h 11m
      3 hours, 11 minutes3h 11m
    JulieMidnight
    Complete
    Complete, First published Jan 25, 2017
    A collection of stories all connected by one thing: Crescent City, the domain of werewolves. Slip through the streets of this city of magic and luxury, and you'll see alpha-kings with scars beneath their suits and blood staining the diamonds worn by their queens. Humans may be found there, too, scraping out a life in the spaces between pack territories. Fragile in the face of fangs. Entranced under predatory gazes.
        
        Loyalty unbroken even in death, forbidden love that flares into murder, and dark passions that come to life only in the deep of night.  Welcome to a city that uncovers the beasts hiding in all hearts.
    All Rights Reserved
    • adult
    • alpha
    • alphafemale
    • alphaking
    • alphaqueen
    • darkfantasy
    • fantasy
    • king
    • love
    • mature
    • pack
    • paranormal
    • paranormalromance
    • queen
    • relationship
    • romance
    • short
    • shortstory
    • urbanfantasy
    • werewolfweek
    • werewolves
    adultalphaalphafemalealphakingalphaqueendarkfantasyfantasykinglovematurepackparanormalparanormalromancequeenrelationshipromanceshortshortstoryurbanfantasywerewolfweekwerewolves
    Table of contentsLast updated Mar 28, 2019
    • Queen of Necropolis
    • A Vow in Blood
    • Secrets Well-Lit
    • Rip and Tear
    • A Crimson Howl
    • From the Depths - Part 1
    • From the Depths - Part 2
    • From the Depths - Part 3
    • A/N About From the Depths - Please Read
    • A Chain of Pearls (Part 1 of 3)
    • A Chain of Pearls (Part 2 of 3)
    • A Chain of Pearls (Part 3 of 3)

    Get notified when Love Bites (Crescent City Werewolves: The Short Stories) is updated

    OR

    If you already have an account,

    By continuing, you agree to Wattpad's Terms of Service and Privacy Policy.
    #110darkfantasy
    • Queen of Necropolis
    • A Vow in Blood
    • Secrets Well-Lit
    • Rip and Tear
    • A Crimson Howl
    • From the Depths - Part 1
    • From the Depths - Part 2
    • From the Depths - Part 3
    • A/N About From the Depths - Please Read
    • A Chain of Pearls (Part 1 of 3)
    • A Chain of Pearls (Part 2 of 3)
    • A Chain of Pearls (Part 3 of 3)
    Report this story
    You may also like
    Kiss of Shadows [Claiming Series, #4] by livinliterary
    Kiss of Shadows [Claiming Series, #4]
    16 parts Complete
    16 parts
    Complete
    A vampire mage and a modern cop team up to battle evil magic... When police sergeant Caro Harringt...
    Evolution by MNJGreenhill
    Evolution
    39 parts Complete
    39 parts
    Complete
    They thought life might return to normal. They were wrong. After putting a stop to Elise's genocid...
    Not My Fairytale by RenniferLopez
    Not My Fairytale
    53 parts Complete
    53 parts
    Complete
    For a moment, the whole world went still. In that split second, my eyes found the source of my unea...
    Fin's Claim by Whiskeyqueenn
    Fin's Claim
    122 parts Complete
    122 parts
    Complete
    This time around the story concentrates on Fin and Victoria and their ill-fated mate pairing. Unaw...
    Bad Moon by WeHoardCats
    Paid Stories Badge
    Bad Moon
    65 parts Complete
    65 parts
    Complete
    Narrowly escaping an attack by wolves, Jaylin Maxwell is driven towards the alluring Quentin Bronx...
    The Ancients by MissFantasyy
    The Ancients
    47 parts Complete
    47 parts
    Complete
    BOOK ONE - promised series Catherine Black learns the hard way that some things are meant to fall a...
    Beneath The Full Moon {TMT #1} by BlackKnight77
    Beneath The Full Moon {TMT #1}
    16 parts Complete
    16 parts
    Complete
    BOOK ONE IN THE MOON TRILOGY ☆~☆~☆ An ordinary bus tour turns into a living nightmare after a grou...
    Good As Dead by JulieMidnight
    Good As Dead
    22 parts Complete
    22 parts
    Complete
    Nina Belmonte knows her way around death. As the daughter of skin witches lost in a magical catastr...
    A Hope from Heaven by TeaHouseQueens
    A Hope from Heaven
    9 parts Complete
    9 parts
    Complete
    Aleksandr has been searching for his female for as long as he could. He is willing to go to the end...
    The Hollow Moon (Downworlder Series, #2) by TeaHouseQueens
    The Hollow Moon (Downworlder Series, #2)
    32 parts Complete
    32 parts
    Complete
    Book Two of the Downworlder Series ~~~~~~~~~~~ High in the mountains, far from the...
    You may also like
    • Kiss of Shadows [Claiming Series, #4] cover
      blood
    • Evolution cover
      action
    • Not My Fairytale cover
      adventure
    • Fin's Claim cover
      alpha
    • Bad Moon cover
      Paid Stories Badge alpha
    • The Ancients cover
      adventure
    • Beneath The Full Moon {TMT #1} cover
      beast
    • Good As Dead cover
      action
    • A Hope from Heaven cover
      amlkoski
    • The Hollow Moon (Downworlder Series, #2) cover
      annamlkoski

    Kiss of Shadows [Claiming Series, #4]

    16 parts Complete
    16 parts
    Complete

    A vampire mage and a modern cop team up to battle evil magic... When police sergeant Caro Harrington witnesses a man being killed by an invisible assailant, she suspects a detective agency with a re...

    Start reading
    • Paid Stories
    • Try Premium
    • Get the App
    • Language
    • Writers
    • |
    • Business
    • Jobs
    • Press
    • Terms
    • Privacy
    • Accessibility
    • Help
    • © 2022 Wattpad