•  
    • Browse
    • Paid Stories
    • Editor's Picks
    • The Wattys
    • Adventure
    • Contemporary Lit
    • Diverse Lit
    • Fanfiction
    • Fantasy
    • Historical Fiction
    • Horror
    • Humor
    • LGBTQ+
    • Mystery
    • New Adult
    • Non-Fiction
    • Paranormal
    • Poetry
    • Romance
    • Science Fiction
    • Short Story
    • Teen Fiction
    • Thriller
    • Werewolf
    • Wattpad Picks
    • Editors' Choice
    • Cottagecore: Good Vibes 🌻
    • Tourist Romance Life 💖
    • From our Creators
    • Wattpad Studios Hits
    • Where LGBTQIA+ stories live 🏳️‍🌈
    • The Watty Awards
    • Community Happenings
    • Wattpad Ambassadors
      • Create a new storyCreate a new story
      • My Stories
      • Helpful writer resources
      • Wattpad programs & opportunities
      • Writing contests
    Try Premium
    Log in Sign Up
    Love Bites (Crescent City Werewolves: The Short Stories)
    Love Bites (Crescent City Werewolve...
    JulieMidnight
    • Reads
      Reads 39,169
      39,16939.1K
    • Votes
      Votes 1,953
      1,9531.9K
    • Parts
      Parts 14
      1414
    • Time
      Time 3h 55m
      3 hours, 55 minutes3h 55m
    Start reading
    • Reads
      Reads 39,169
      39,16939.1K
    • Votes
      Votes 1,953
      1,9531.9K
    • Parts
      Parts 14
      1414
    • Time
      Time 3h 55m
      3 hours, 55 minutes3h 55m
    JulieMidnight
    Complete
    Complete, First published Jan 25, 2017
    A collection of stories all connected by one thing: Crescent City, the domain of werewolves. Slip through the streets of this city of magic and luxury, and you'll see alpha-kings with scars beneath their suits and blood staining the diamonds worn by their queens. Humans may be found there, too, scraping out a life in the spaces between pack territories. Fragile in the face of fangs. Entranced under predatory gazes.
        
        Loyalty unbroken even in death, forbidden love that flares into murder, and dark passions that come to life only in the deep of night.  Welcome to a city that uncovers the beasts hiding in all hearts.
    All Rights Reserved
    • adult
    • alpha
    • alphafemale
    • alphaking
    • alphaqueen
    • darkfantasy
    • fantasy
    • king
    • love
    • mature
    • pack
    • paranormal
    • paranormalromance
    • queen
    • relationship
    • romance
    • short
    • shortstory
    • urbanfantasy
    • werewolfweek
    • werewolves
    adultalphaalphafemalealphakingalphaqueendarkfantasyfantasykinglovematurepackparanormalparanormalromancequeenrelationshipromanceshortshortstoryurbanfantasywerewolfweekwerewolves
    Table of contents
    • Queen of Necropolis
      Fri, Feb 3, 2017
    • A Vow in Blood
      Sun, Feb 19, 2017
    • Secrets Well-Lit
      Fri, Mar 3, 2017
    • Rip and Tear
      Wed, Mar 8, 2017
    • A Crimson Howl
      Thu, May 25, 2017
    • A Chain of Pearls (Part 1 of 3)
      Wed, Mar 13, 2019
    • A Chain of Pearls (Part 2 of 3)
      Mon, Mar 18, 2019
    • A Chain of Pearls (Part 3 of 3)
      Thu, Mar 28, 2019
    • Tides of Silver and Blood (Part 1 of 6)
      Sat, Mar 4, 2023
    • Tides of Silver and Blood (Part 2 of 6)
      Sat, Mar 4, 2023
    • Tides of Silver and Blood (Part 3 of 6)
      Sat, Mar 4, 2023
    • Tides of Silver and Blood (Part 4 of 6)
      Sat, Mar 4, 2023
    • Tides of Silver and Blood (Part 5 of 6)
      Sat, Mar 4, 2023
    • Tides of Silver and Blood (Part 6 of 6)
      Sat, Mar 4, 2023

    Get notified when Love Bites (Crescent City Werewolves: The Short Stories) is updated

    OR

    If you already have an account,

    By continuing, you agree to Wattpad's Terms of Service and Privacy Policy.
    A collection of stories all connected by one thing: Crescent City, the domain of werewolves. Slip through the streets of this city of magic and luxury, and you'll see alpha-kings with scars beneath their suits and blood staining the diamonds worn by their queens. Humans may be found there, too, scraping out a life in the spaces between pack territories. Fragile in the face of fangs. Entranced under predatory gazes.
        
        Loyalty unbroken even in death, forbidden love that flares into murder, and dark passions that come to life only in the deep of night.  Welcome to a city that uncovers the beasts hiding in all hearts.

    14 parts

    • Tides of Silver and Blood (Part 4 of 6)
      Sat, Mar 4, 2023
    • Tides of Silver and Blood (Part 5 of 6)
      Sat, Mar 4, 2023
    • Tides of Silver and Blood (Part 6 of 6)
      Sat, Mar 4, 2023
    #959short
    Content Guidelines
    You may also like
    Pessimist by v1carious
    Pessimist
    49 parts Complete Mature
    49 parts
    Complete
    Mature
    [01/07/2021] - [13/04/2023] "You can't keep going around like a fucking maniac and treating me like...
    Good As Dead by JulieMidnight
    Good As Dead
    22 parts Complete
    22 parts
    Complete
    Nina Belmonte knows her way around death. As the daughter of skin witches lost in a magical catastr...
    Skinned: A Selkie Short Story by JulieMidnight
    Skinned: A Selkie Short Story
    1 part Complete
    1 part
    Complete
    A night watchman with a past so horrific that he has been stripped of even his name. A young bride...
    Kill For It by _himeros_
    Kill For It
    47 parts Ongoing Mature
    47 parts
    Ongoing
    Mature
    My hands pull at the cuffs straining my arms above my head as he takes me ruthlessly. His prisoner...
    Secrets in the Moon (Crescent City Werewolves #1) by JulieMidnight
    Secrets in the Moon (Crescent City Werewolve...
    36 parts Complete
    36 parts
    Complete
    Savage appetites and opulent vices are a way of life in Crescent City, a metropolis split among wer...
    Kiss of Shadows [Claiming Series, #4] by livinliterary
    Kiss of Shadows [Claiming Series, #4]
    16 parts Complete
    16 parts
    Complete
    A vampire mage and a modern cop team up to battle evil magic... When police sergeant Caro Harringt...
    Drakkon by CrestFallenStar
    Drakkon
    62 parts Complete
    62 parts
    Complete
    When Daiyu is summoned with dozens of other girls to be the Emperor's concubine, she doesn't think...
    The King's Harem by LChristiani
    The King's Harem
    49 parts Complete Mature
    49 parts
    Complete
    Mature
    The King's Harem is actively under construction!! If you happen to be reading it currently and thin...
    The Kings Luna *undergoing major editing* by Young-Queen_Izzy
    The Kings Luna *undergoing major editing*
    17 parts Ongoing Mature
    17 parts
    Ongoing
    Mature
    Highest rank: #1 in werewolf on 07/14/2016 *currently undergoing editing, weekly update...
    Four's Game (SEU, #1) [SAMPLE] by UniqueAlexJ
    Four's Game (SEU, #1) [SAMPLE]
    7 parts Complete Mature
    7 parts
    Complete
    Mature
    #1 Southeastern University Series Natosha Jackson is from the south-side slums of Ridgeport. She's...
    You may also like
    • Pessimist cover
      badpast
    • Good As Dead cover
      action
    • Skinned: A Selkie Short Story cover
      dark
    • Kill For It cover
      action
    • Secrets in the Moon (Crescent City Werewolves #1) cover
      1920s
    • Kiss of Shadows [Claiming Series, #4] cover
      blood
    • Drakkon cover
      blood
    • The King's Harem cover
      18andup
    • The Kings Luna *undergoing major editing* cover
      alpha
    • Four's Game (SEU, #1) [SAMPLE] cover
      africanamerican

    Pessimist

    49 parts Complete Mature
    49 parts
    Complete
    Mature

    [01/07/2021] - [13/04/2023] "You can't keep going around like a fucking maniac and treating me like shit. That isn't how relationships work," Sophia's voice was havoc as she verbalized her emotions...

    Start reading
    • Paid Stories
    • Try Premium
    • Get the App
    • Language
    • Writers
    • |
    • Business
    • Jobs
    • Press
    • Terms
    • Privacy
    • Accessibility
    • Help
    • © 2023 Wattpad