Story cover for Love Bites (Crescent City Werewolves: The Short Stories) by JulieMidnight
Love Bites (Crescent City Werewolves: The Short Stories)
JulieMidnight
  • WpView
    Reads 43,878
  • WpVote
    Votes 2,183
  • WpPart
    Parts 14
  • WpHistory
    Time 3h 56m
  • WpView
    Reads 43,878
  • WpVote
    Votes 2,183
  • WpPart
    Parts 14
  • WpHistory
    Time 3h 56m
JulieMidnight
Complete, First published Jan 25, 2017
adultalphaalphafemalealphakingalphaqueendarkfantasyfantasykinglovematurepackparanormalparanormalromancequeenrelationshipromanceshortshortstoryurbanfantasywerewolfweekwerewolves
A collection of stories all connected by one thing: Crescent City, the domain of werewolves. Slip through the streets of this city of magic and luxury, and you'll see alpha-kings with scars beneath their suits and blood staining the diamonds worn by their queens. Humans may be found there, too, scraping out a life in the spaces between pack territories. Fragile in the face of fangs. Entranced under predatory gazes.

Loyalty unbroken even in death, forbidden love that flares into murder, and dark passions that come to life only in the deep of night.  Welcome to a city that uncovers the beasts hiding in all hearts.
All Rights Reserved
adultalphaalphafemalealphakingalphaqueendarkfantasyfantasykinglovematurepackparanormalparanormalromancequeenrelationshipromanceshortshortstoryurbanfantasywerewolfweekwerewolves
Table of contents

14 parts

Sign up to add Love Bites (Crescent City Werewolves: The Short Stories) to your library and receive updates
or
#195short
Content Guidelines
You may also like
Her Tyrant Alpha [EXCERPT] by ESHurricane
6 parts Complete Mature
*Available in full on Radish or Patreon!* She was born in fire. He was forged in ice. The clash will scorch them both. After a disease wipes out all human life on earth, the world is left to the werewolves. As packs organize and claim territory, an opportunity arises to collect information from a Viking pack headed by the dangerous alpha, Nolan Frosaker. Ashelin jumps at the chance to go undercover, but only partly because she wants to contribute to the mission. The Viking King intrigues her, and she has unique talents that will get her close to him. What she doesn't anticipate is Nolan's own unique talents, and how quickly she desires to be completely at his mercy. Warnings: This story is rated mature for a reason. Rated NC-17 for very intense bdsm power play in an environment that wouldn't be safe if it were humans not in fiction. NOTE: This story takes place in the Bloodlines universe, but can be read as a standalone. If you're curious about the apocalypse and want more of Ashelin and her previous pack, check out Bloodlines Vol. 1 for the first entry in that series and info on reading the rest!
The Blood Moon Pack (Completed) by pinkxdementorxx
30 parts Complete
(Editing grammar and sentence structure) Losing your parents at three years of age and having to grow up too soon to rule the most feared pack in the world is no easy feat. Yet, Alpha Vincent Black manages it all. He's known to be cold and ruthless, yet his pack says otherwise. Not being taught how to love, Alpha Vincent tried his hardest to ensure that his pack is always happy and flourishing, while keeping all possible threats from outsiders at bay. Then, his Bella enters his life. His precious mate. The one woman fit to chase away all of Alpha Vincent's monsters and teach him how to love. She becomes his priority. What will happen to their perfect love story when betrayal is in the air? When whatever they have known was all just a lie. Will their love survive all the obstacles thrown at them, or will it just die away as all good things come to an end? 🐾🐾🐾
Pure Paws by JocelynSmock
39 parts Complete Mature
Tsk-tsk. Alex Hayes lets her anger get the best of her one horrible day. An abusive father takes role in beating his child senseless everyday for two years straight. Alex's true beast takes over and saves her life. This gives her hope of a long journey that lays ahead. Christopher Black is an alpha of an extremely small yet powerful pack, the 'Crescent Moon' pack. A not yet found Luna will take action in her command and fall for her mate. They live happily for a while before things take turn for the worst. A certain powerful one must step up and fulfill a long told prophecy which will save Were kind. There is only one issue standing in the way of this. Now, revenge will be replaced. Love will lose it's fall. Fatal mistakes will be made. Read on to find out the answers to more questions. But, may I ask you this one question? Are you ready to be sucked up into the world of terror and the great story of untold love and power? **Copyright of JocelynSmock**
The Alpha's Queen by heater0387
39 parts Ongoing Mature
Devany Sterling spent her entire childhood moving between one foster family and the next. As an adult, she follows the few clues she has about her parents, but it isn't long before she runs into a dead end. Stuck bartending in the small mountain town of Silver City, she starts to wonder if it's time she lets go of the past and starts living in the present, but then Beckett Warner wanders into her bar. Alpha Marked at birth, Beckett always knew he was meant to lead, but his dreams of changing the outdated laws and traditions of the Wolf Packs are constantly met with resistance by those who are afraid change will take away their power. But when the magnetic pull of fate brings Devany into his world, his priorities shift. United by an unforeseen bond, they unearth a shared destiny that could shatter the foundations of their existence. Amidst a brewing storm of deception and treachery, they discover a profound truth: their fates have always been tied together, and those in power will do everything to keep them apart. *this story contains mature themes
The Rise of Venus by cosmic_lattes
71 parts Complete Mature
|𝟐𝟑𝐱 𝐅𝐄𝐀𝐓𝐔𝐑𝐄𝐃 & 𝐖𝐀𝐓𝐓𝐘𝐒 𝟐𝟎𝟐𝟏 𝐒𝐇𝐎𝐑𝐓𝐋𝐈𝐒𝐓𝐄𝐑| This epic werewolf themed fantasy follows a no-nonsense future Luna, 𝐕𝐄𝐍𝐔𝐒 𝐁𝐑𝐈𝐆𝐇𝐓𝐃𝐎𝐎𝐌, as she embarks on a high stakes journey to save her people from extinction. Threatened with genocide and war from the cold-blooded dark witches, Venus finds herself cast in The Propehcy of Lost Hope alongside six other werewolves. Fate dictates that to prevent catastrophe the Seven Stars must complete the tasks set forth in the prophecy before the Winter Equinox. The catch? If they fail then Venus has to sacrifice her Mate to in order to preserve the continuity of her race. Caught in a web of love, lies, and secrets. Venus and her newfound friends must face not only the dangers of the past and present. But the demons that slumber deep within. As time passes and things get more complicated, it becomes clear why the prophecy states they can be the saviors that protect their people. Or the foes that lead to their destruction. 𝐒𝐭𝐚𝐭𝐮𝐬: 𝐂𝐨𝐦𝐩𝐥𝐞𝐭𝐞 𝐆𝐞𝐧𝐫𝐞: 𝐖𝐞𝐫𝐞𝐰𝐨𝐥𝐟, 𝐟𝐚𝐧𝐭𝐚𝐬𝐲, 𝐫𝐨𝐦𝐚𝐧𝐜𝐞, 𝐝𝐢𝐯𝐞𝐫𝐬𝐞 𝐥𝐢𝐭 𝐒𝐭𝐚𝐫𝐭𝐞𝐝: 𝟎𝟏/𝟏𝟎/𝟐𝟏 𝐅𝐢𝐧𝐢𝐬𝐡𝐞𝐝: 𝟎𝟕/𝟐𝟖/𝟐𝟏 𝐑𝐚𝐭𝐢𝐧𝐠: 𝟏𝟖+ 𝐟𝐨𝐫 𝐠𝐥𝐨𝐬𝐬𝐞𝐝 𝐨𝐯𝐞𝐫 𝐄𝐃, 𝐬𝐮𝐢𝐜𝐢𝐝𝐞, 𝐯𝐢𝐨𝐥𝐞𝐧𝐜𝐞, & 𝐬𝐦𝐮𝐭 𝐂𝐨𝐯𝐞𝐫: 𝐂𝐉 𝐃𝐞𝐬𝐢𝐠𝐧
Rille (Tribes, Book 2) [temporarily paused] by xfablex
34 parts Ongoing
Preston's pack prides itself on purity. Which means a human mate is unacceptable, especially for the newly-proclaimed alpha. One adrenaline-induced mistake is all it takes to bring a screeching halt to any pre-planned engagements. Preston never wanted to upset his father, the retired alpha, but he didn't have a choice. When his wolf made up his mind, there was no stopping him. But in a reservation full of ancient rituals and rites, will he be able to keep his new mate safe? With her past looming like a deadly weapon, will either of them be able to cope? ************ Updates weekly on Tuesdays
Crescent (Tribes, Book 1) [completed] by xfablex
39 parts Complete Mature
*Now rated Mature because of final chapter* In a world where shifters live on reservations and cater to the human's whims, there are also advantages to the laws made to protect their interests. Mating Laws are as common as the prejudice that surrounds the werewolves. Conner, future alpha of the Crescent tribe of wolves. When Conner's wolf finds their mate in the middle of a chaotic day, Conner sets into motion the plans that will bring her to his side forever. One future alpha, one human, and decades of bias, desperation, and prejudice collide on the res. Will they be able to find each other's hearts and protect them? Or will wolf politics and judgment keep them apart?
Unsuitable Match by simply-caitlyn
24 parts Complete Mature
"You're not a luna. You're a rogue. Your word means nothing." Maddie says. "Alpha Kairo, I hear you don't have a luna yet. If you ever need a backup, I have experience being trained." Maddie says, fluttering her eyelashes at him. "Training to sleep around until you get a luna ranking? You really are a desperate, pathetic bitch." I say. "Well, at least I'm not going to die alone. Out of all of us, I'm going to find my mate first." Maddie argues. "What makes you think I'm not with someone?" <~~~~~~~~~~> ~Published on March 16, 2021~ ~Completed on January 2, 2022~
Rejecting the Alpha by Kira_t10
55 parts Complete
I glared up at him my eyes narrowed, "Excuse me?" I was beyond livid by the words that just came out of his mouth. My glare didn't falter when Parker towered over me, clenching his jaw while trapping me against his desk. "You heard me." Parker's voice was low and intimidating that it made me feel so small. But I wasn't going to let him get to me. Standing up taller, I snapped, "I will not be your personal toy, available for you to do just as you please! I do not want to be held captive against my will, and not even have a say in anything. To be honest, I don't even want a mate." "You will do everything and anything I say, do you hear me?" Parker growled grabbing my chin and forcing me to look at him. Without even thinking I said the first thing that came to my head but meant every word. "I, Jasmine Davis, reject you Alpha Parker Mason, as my mate." * Jasmine Davis is the daughter of the Beta of the Moonlit Waters Pack. She's sarcastic and having a mate is that last thing on her mind. Jasmine gets the attention of most of the male population in her pack but she ignores them. What happens when Jasmine's mate happens to be the ruthless Alpha of the neighboring pack, the Lunar Shadow Pack. What happens when she doesn't want a mate especially, Alpha Parker? * [Highest rank: #1] [WARNING] - mild language and some steamy scenes* [Unedited] Read at your own risk! [Published: November 2015] [Completed: July 2017]
You may also like
Slide 1 of 9
Her Tyrant Alpha [EXCERPT] cover
The Blood Moon Pack (Completed) cover
Pure Paws cover
The Alpha's Queen cover
The Rise of Venus cover
Rille (Tribes, Book 2) [temporarily paused] cover
Crescent (Tribes, Book 1) [completed] cover
Unsuitable Match cover
Rejecting the Alpha cover

Her Tyrant Alpha [EXCERPT]

6 parts Complete Mature

*Available in full on Radish or Patreon!* She was born in fire. He was forged in ice. The clash will scorch them both. After a disease wipes out all human life on earth, the world is left to the werewolves. As packs organize and claim territory, an opportunity arises to collect information from a Viking pack headed by the dangerous alpha, Nolan Frosaker. Ashelin jumps at the chance to go undercover, but only partly because she wants to contribute to the mission. The Viking King intrigues her, and she has unique talents that will get her close to him. What she doesn't anticipate is Nolan's own unique talents, and how quickly she desires to be completely at his mercy. Warnings: This story is rated mature for a reason. Rated NC-17 for very intense bdsm power play in an environment that wouldn't be safe if it were humans not in fiction. NOTE: This story takes place in the Bloodlines universe, but can be read as a standalone. If you're curious about the apocalypse and want more of Ashelin and her previous pack, check out Bloodlines Vol. 1 for the first entry in that series and info on reading the rest!

More details