•  
    • Browse
    • Paid Stories
    • Editor's Picks
    • The Wattys
    • Adventure
    • Contemporary Lit
    • Diverse Lit
    • Fanfiction
    • Fantasy
    • Historical Fiction
    • Horror
    • Humor
    • LGBTQ+
    • Mystery
    • New Adult
    • Non-Fiction
    • Paranormal
    • Poetry
    • Romance
    • Science Fiction
    • Short Story
    • Teen Fiction
    • Thriller
    • Werewolf
    • Wattpad Picks
    • Editors' Choice
    • Where LGBTQIA+ stories live 🏳️‍🌈
    • Cottagecore: Bad Vibes 🕯️
    • Cottagecore: Good Vibes 🌻
    • From our Creators
    • Wattpad Studios Hits
    • The Watty Awards
    • Community Happenings
    • Wattpad Ambassadors
      • Create a new storyCreate a new story
      • My Stories
      • Helpful writer resources
      • Wattpad programs & opportunities
      • Writing contests
    Try Premium
    Log in Sign Up
    Worth
    Worth
    SeventyMurphy
    • Reads
      Reads 242,074
      242,074242K
    • Votes
      Votes 16,237
      16,23716.2K
    • Parts
      Parts 34
      3434
    • Time
      Time 6h 19m
      6 hours, 19 minutes6h 19m
    Start reading
    • Reads
      Reads 242,074
      242,074242K
    • Votes
      Votes 16,237
      16,23716.2K
    • Parts
      Parts 34
      3434
    • Time
      Time 6h 19m
      6 hours, 19 minutes6h 19m
    SeventyMurphy
    Complete
    Complete, First published Feb 15, 2016
    When an eccentric old neighbour dies and names Violet March in his will, she is even more surprised than his estranged and spoiled family. To make matters stranger, she learns that all must attend a pretend murder-mystery weekend for any to claim a share of the inheritance. Being a good sport under constant scrutiny and suspicion becomes trickier when she finds herself torn between the romantic attentions of both the deceased's "favourite" grand-nephew and the charming black sheep of the family. Loyalty forces her to favour the former, but when it is the latter who inherits the bulk of the estate, a grave case of mistaken identities is revealed leaving Violet to determine whether pride and an unwillingness to be labelled a gold-digger may stand in the way of the love of a lifetime.
        
        *Cover from "Lake Louise, An Alpine Wonderland" by Norman Fraser, which is to the best of my research and knowledge in the Public Domain.
        
        *No part of this book may be reproduced or used in any manner without the express written permission of the author.
    All Rights Reserved
    • blacksheep
    • chicklit
    • christmas
    • fake
    • family
    • farce
    • fiction
    • humour
    • inheritance
    • love
    • mistake
    • murdermystery
    • party
    • quirky
    • retro
    • romance
    • romcom
    • seance
    • sisters
    • sweet
    blacksheepchicklitchristmasfakefamilyfarcefictionhumourinheritancelovemistakemurdermysterypartyquirkyretroromanceromcomseancesisterssweet
    Table of contents
    • Chapter 1 (Pt 1)
      Wed, Feb 17, 2016
    • Chapter 1 (cont.)
      Mon, Feb 15, 2016
    • Chapter 2 (Pt 1)
      Mon, Feb 15, 2016
    • Chapter 2 (cont.)
      Mon, Feb 15, 2016
    • Chapter 3 (Pt 1)
      Wed, Feb 17, 2016
    • Chapter 3 (cont.)
      Wed, Feb 17, 2016
    • Chapter 4
      Mon, Feb 22, 2016
    • Chapter 5 (Pt 1)
      Mon, Feb 29, 2016
    • Chapter 5 (cont.)
      Mon, Feb 29, 2016
    • Chapter 6 (Pt. 1)
      Mon, Feb 29, 2016
    • Chapter 6 (cont.)
      Mon, Mar 7, 2016
    • Chapter 7 (Pt. 1)
      Mon, Mar 7, 2016
    • Chapter 7 (cont.)
      Mon, Mar 7, 2016
    • Chapter 8 (Pt. 1)
      Mon, Mar 14, 2016
    • Chapter 8 (cont.)
      Tue, Mar 15, 2016
    • Chapter 9 (Pt. 1)
      Mon, Mar 21, 2016
    • Chapter 9 (cont.)
      Mon, Mar 21, 2016
    • Chapter 10 (Pt. 1)
      Mon, Mar 28, 2016
    • Chapter 10 (cont.)
      Mon, Mar 28, 2016
    • Chapter 11 (Pt. 1)
      Mon, Mar 28, 2016
    • Chapter 11 (cont.)
      Mon, Mar 28, 2016
    • Chapter 12 (Pt. 1)
      Mon, Apr 4, 2016
    • Chapter 12 (cont.)
      Mon, Apr 4, 2016
    • Chapter 13
      Mon, Apr 4, 2016
    • Chapter 14 (Pt. 1)
      Mon, Apr 4, 2016
    • Chapter 14 (cont.)
      Mon, Apr 4, 2016
    • Chapter 15
      Mon, Apr 11, 2016
    • Chapter 16 (Pt. 1)
      Mon, Apr 11, 2016
    • Chapter 16 (cont.)
      Mon, Apr 11, 2016
    • Chapter 17 (Pt. 1)
      Wed, Apr 20, 2016
    • Chapter 17 (cont.)
      Wed, Apr 20, 2016
    • Chapter 18 (Pt. 1)
      Wed, Apr 20, 2016
    • Chapter 18 (cont.)
      Wed, Apr 20, 2016
    • Chapter 19
      Wed, Apr 20, 2016

    Get notified when Worth is updated

    OR

    If you already have an account,

    By continuing, you agree to Wattpad's Terms of Service and Privacy Policy.
    When an eccentric old neighbour dies and names Violet March in his will, she is even more surprised than his estranged and spoiled family. To make matters stranger, she learns that all must attend a pretend murder-mystery weekend for any to claim a share of the inheritance. Being a good sport under constant scrutiny and suspicion becomes trickier when she finds herself torn between the romantic attentions of both the deceased's "favourite" grand-nephew and the charming black sheep of the family. Loyalty forces her to favour the former, but when it is the latter who inherits the bulk of the estate, a grave case of mistaken identities is revealed leaving Violet to determine whether pride and an unwillingness to be labelled a gold-digger may stand in the way of the love of a lifetime.
        
        *Cover from "Lake Louise, An Alpine Wonderland" by Norman Fraser, which is to the best of my research and knowledge in the Public Domain.
        
        *No part of this book may be reproduced or used in any manner without the express written permission of the author.

    34 parts

    • Chapter 18 (Pt. 1)
      Wed, Apr 20, 2016
    • Chapter 18 (cont.)
      Wed, Apr 20, 2016
    • Chapter 19
      Wed, Apr 20, 2016
    #203blacksheep
    Content Guidelines
    You may also like
    Auf'd (The Belinda & Bennett Mysteries, Book Two) by amy_saunders
    Auf'd (The Belinda & Bennett Mysteries, Book...
    31 parts Complete
    31 parts
    Complete
    Lending a hand to a charity fashion show sounded like such fun. Now if only Belinda's idea of a goo...
    The Many Dates of Indigo by AmethystAmber87
    Paid Stories Badge
    The Many Dates of Indigo
    117 parts Complete
    117 parts
    Complete
    The Many Dates of Indigo is now published as a Paperback, and E-book with W by Wattpad Books! As a...
    Who Kissed Charlie Fine? by SeventyMurphy
    Who Kissed Charlie Fine?
    23 parts Complete
    23 parts
    Complete
    Inquisitive heir, Charlie Fine's obsession with the truth makes him an excellent fraud investigator...
    Sold to a Wolf Pack by MiaMeade
    Sold to a Wolf Pack
    144 parts Ongoing
    144 parts
    Ongoing
    "My dad sold me to a pack of werewolves to settle his gambling debt." ❀ "I'm going to count to thre...
    Playmaker [ongoing] by AveryKeelan
    Playmaker [ongoing]
    1 part Ongoing Mature
    1 part
    Ongoing
    Mature
    Pro hockey superstar Gabriel Carter has everything: a thriving professional hockey career, an MVP t...
    His Serenity by Stella_Cadante
    His Serenity
    47 parts Ongoing
    47 parts
    Ongoing
    In the realm of guns, lies, deception and beasts, an angel was born "Damn it!" ---
    The Favoured, The Fair and Ms. Vérité Claire by SeventyMurphy
    Paid Stories Badge
    The Favoured, The Fair and Ms. Vérité Claire
    25 parts Complete
    25 parts
    Complete
    Can an insecure beauty tame a self-sabotaging beast? When Julia Swift agrees to pose as vengeful f...
    Lust Next Door by Virgoswriter2
    Lust Next Door
    46 parts Ongoing Mature
    46 parts
    Ongoing
    Mature
    ~•~ 26 year old, Connor Deluca, is a professional Hockey player in the NHL; who just moved into the...
    You may also like
    • Auf'd (The Belinda & Bennett Mysteries, Book Two) cover
      chicklit
    • The Many Dates of Indigo cover
      Paid Stories Badge blackwoman
    • Who Kissed Charlie Fine? cover
      affair
    • Sold to a Wolf Pack cover
      action
    • Playmaker [ongoing] cover
      adultromance
    • His Serenity cover
      arrogant
    • The Favoured, The Fair and Ms. Vérité Claire cover
      Paid Stories Badge beauty
    • Lust Next Door cover
      18plus

    Auf'd (The Belinda & Bennett Mysteries, Book Two)

    31 parts Complete
    31 parts
    Complete

    Lending a hand to a charity fashion show sounded like such fun. Now if only Belinda's idea of a good time included a smothered designer and trouble with Bennett. While Belinda balances opening a busi...

    Start reading
    • Paid Stories
    • Try Premium
    • Get the App
    • Language
    • Writers
    • |
    • Business
    • Jobs
    • Press
    • Terms
    • Privacy
    • Accessibility
    • Help
    • © 2023 Wattpad