Spider-Man The Web Slinger of Remnant
FlipDaPageS117
  • Reads 1,136
  • Votes 39
  • Parts 13
  • Time 8h 13m
  • Reads 1,136
  • Votes 39
  • Parts 13
  • Time 8h 13m
FlipDaPageS117
Ongoing, First published Sep 24, 2021
Mature
actionaction-adventureadventureblakebelladonadramahumormarvelroossterteethrubyroserwbyrwbyfanficspider-manspidermanweissschneeyangxiaolong
*Long uploads* 

Description:

Flynn Redmond always wanted to be something more than being a normal teenage boy in High school. He wanted to be a huntsmen like in the old tales his grandparents would read to him. Defending people who couldn't protect themselves. He wanted to inspire hope to those in need, he wanted to be a hero. But unfortunately for Flynn, his aura was weak, he lacked sufficient combat skills, and no semblance to speak of. He was considered the weakest among his peers and every Combat school and Huntsman academy's he applied to, turned him down, didn't meet the requirements, or was ignored. Flynn thought his dreams of becoming a huntsmen were over. Until one day on a school field trip to Atlas, that one bite from a radioactive spider would change his life forever.

I don't own Spider Man or RWBY 

Spider man is owned by Marvel, Disney, and Sony 

RWBY is owned by Rooster Teeth
All Rights Reserved
actionaction-adventureadventureblakebelladonadramahumormarvelroossterteethrubyroserwbyrwbyfanficspider-manspidermanweissschneeyangxiaolong
Table of contents

13 parts

Sign up to add Spider-Man The Web Slinger of Remnant to your library and receive updates
or
Content Guidelines
You may also like
(Volume 2) Mythical Rose (OLD) by Genesic_Herrscher
18 parts Complete Mature
Team RWBY and Team RCST grow a stronger friendship with each other as the first semester ends, even with a... long awaiting relationship to blossom but only after they've been through a very rough time Also I DO NOT OWN RWBY NOR ANY PICTURES OR MUSIC I'LL USE. KEEP. THAT. IN MIND! RWBY belongs to Rooster Teeth and Monty Oum, May his soul Rest In Peace
[Part 1] A New Assassin (An Assassin's Creed x RWBY AU story) by Warlord-Dregon
32 parts Complete Mature
[PART 1 IS COMPLETE! PART 2 HAS BEEN CANCELLED!] As a child, y/n always heard voices. And rarely, he swears he saw someone. He was abused by his father and siblings. Sometimes his uncles and cousins did as well but for unknown reasons. He never got help from his mother or aunts as they went missing years ago. He never understood why he was mistreated. When he went to Beacon, he thought that it was all over. But as he had terrible luck as usual, he was wrong. He was bullied by most of the students including team CRDL since he was the weakest student in the whole school. His siblings were there was well, making his situation even worse. He thought out help from the teachers, but they wouldn't help at all, they would usually either telling him to get stronger or go home. One day, Ozpin sent him off on a mission to collect something that he wasn't told of. When he does, it was all a trap by an unknown group. As he's kidnapped, he finds something very old and he becomes someone else completely; an Assassin. He'll soon understand the world more and the words that he always heard but never understood will finally make sense: "Where other men blindly follow the truth, Remember, nothing is true. Where other men are limited by morality or law, Remember, everything is permitted. We work in the dark to serve the light. We are assassins." Key factors about this story: 1. Each sequence is the main story. 2. Lost sequences are stuff that either happened before or things that I forgot to add at some point, so they're cannon and probably are important to the story. Lost sequences can be about anyone in the story. I don't own rwby or Assassin's Creed. Rwby belongs to Rooster Teeth and Assassin's Creed belongs to Ubisoft. I also don't own any pictures, gifs, or videos. Spoiler: If you REALLY want to know about the romance part of this story, though it'll mainly start in part 2, then continue reading: This is a Yang x male reader story.
The Wilted Rose by Zach42799
92 parts Complete Mature
Y/N Rose was the son of Qrow Branwen and Summer Rose, and the oldest child of the Rose family. Due to Qrows' semblance and a messy end to they're relationship, He was mostly absent but he did try to be there for the children when he could. But everything soon went down hill when Summer disappeared. The children where heartbroken but Tai, saddened and enraged at Summers disappearance began to take his frustrations out on the children. Y/N would try to make the most of it, and protect Yang and Ruby from Tais' wrath, often times taking a beating and going without food for days. As time went on Tai got increasingly worse, and Y/N became the sole target of abuse. Yang and Ruby would try to help as best they could but it wasn't enough, Y/N could bare it no more. Y/N attempted to contact Qrow and reveal the conditions and fear they lived in, But Tai got him first. Beaten bloodied, Y/N would take a moment to recover and escape with his sisters.... But destiny had other plans. Rwby is the property of Roosterteeth. Red hood and any comic panels are property of DC. I do however hold ownership of any OC's I might create. Any art or music used belong to their respective creators.
The Wilted Rose Book 3: Knightfall by Zach42799
62 parts Ongoing Mature
"The world isn't black and white. That's why I deal in shades of grey..." At last, Y/n Rose has reached Atlas, much to his own disappointment. With his memories of his past trip to Atlas haunting him everywhere he looks, a shaky alliance between law and lawlessness begins. While it's uncertain how long that alliance will stand, what is certain is that something big is coming. Their enemies putting their biggest and most destructive plan into action, can Y/n finally move past the ghosts of his past, or will he succumb to the darkness he's fought so hard against. One thing he's sure of is that this is the beginning of the end.... Warning: This book contains explicit content that is not for the feint of heart. While the second book was laid back with it's darker aspects, this book will be closer to the first. Be warned for the easily disturbed. This is your one and only warning. Rwby is the property of Roosterteeth. (Or whoever buys the IP) Red hood and any comic panels are property of DC. I do however hold ownership of any OC's I might create. Any art or music used belong to their respective creators.
Why must I suffer? ( A Neglected and abused indra male reader x rwby) by DaredDT44
33 parts Complete Mature
In the kingdom of Mistral, there was a young boy by the name of (Y/n), he never really had a good childhood since his parents and siblings had neglected and abused him, but what is to happen once he discovers that he is a decendant of a ledgendary person? What kind of Adventures and Shenanigans will ensue? find out on "Why must I suffer?" RWBY is owned by rooster teeth and Naruto is owned by Masashi Kishimoto, please don't sue me, also other things used such as music, etc. Are not owned by me and all credit goes to their rightful owners, thank you
THE RONIN by tejoye
9 parts Ongoing Mature
(THE REMAKE).....Depicted as a assassin of death, a harbinger of things to come. But they call me y/n, a former student of beacon academy. Wanting to be like the huntsman and huntresses. However it didn't go so well you see I lost my family years ago the the white fang and I didn't have anyone to support me. Losing them I didn't get stronger because I didn't know what to do. So I thought I could be better and have some friends... but no. I was bullied and ridiculed by many teams at Beacon, then I left.... becoming the lone warrior Ronin. I then will find the people responsible for my families death and kill myself after I'm done. Cause I have nothing to live for
Rwby: The Wilted Rose on The Radiant End. Male Dragon Grimm Faunus xSummer rose by DrkRuna
42 parts Complete Mature
You are a grimm dragon faunus that is being created to destroy the world. Will you destroy the world or save it? I will try my best on this, it I my first book. This takes place after summer has gotten her huntsman license. All pictures go to there owners. I do not own them. Rwby is owned by vizmedia. 6th place in grimm July 2022 107th place in Rwby August 2022. 111th in dragons in October 2022. Omg 3rd place in Emerald ahh October 2022! 1st place in Cinder December 2022 5th place grimm may 2023 1st place emerald April 2024 6th place Rwbyfanfic September 2024. Note for those reading this I made this start off Like a Salem x reader but it changes to a summer x reader later on. I had to make it like that for the story. I thought it would make more dynamic.
The Things I've Seen (A RWBY Male OC Insert) by MartinGraf98
15 parts Complete
(DISCONTINUED) "Don't claim that you know me, 'cause you know very well that I have seen through it all." ???:"Those words still echo in my mind. Graduating from Shade Academy over in Vacuo, I made myself known as a freelancing huntsman. Whether people need protection, Grimm need to be cleared out or they just need information: I have it all.I'm 42 years old already, so I can say I've been through hell many many times. Am I still active? Yes...Do I have a life goal I wanna fulfill? Yes...but who am I? Follow me through the ups and downs to save Remnant from absolute chaos." A/N: It's not my first RWBY story ever, but the first one I'll write and publish here. It's taking place in Volume 5 and later ties into Volume 6. Have fun reading. :)
My Time Has Passed (RWBY X Legendary Huntsman Male Reader) (OLD) by DekuMidoriyaXT_V2
16 parts Complete
(Y/N), The Greatest Huntsman of All Time, have been a hero to everyone in Remnant for quite some time now. Your militaristic training and ideals has shaped the 4 kingdoms permanently. The faunus believes that you will one day take them out of their oppressive captors. The White Fang respects you for your deeds, hoping that one day, you will support them. The Grimm trembles as you walk near them. This was your legacy, what you left behind. But what happens if you came back from the dead? What happens if you saw your beloved world in constant chaos? Will you once again take up arms and fight for good? Or will you deem this planet no longer your own and unleash the wrath that has been inside you ever since? It is time to pick a side. Every decision you make will tip the balance of this already fragile scale. You will meet old and new friends. Be a part of something that you never thought you'll be in again. Oh you know what the ships will be, eheheh. Trying something new here. It's out of my jurisdiction, but this idea was stuck in my head for quite a while now.
RWBY: Light within Darkness by Hedorah67
26 parts Complete Mature
From the moment you were born you were on your own. You had powers which scared everyone around you and you couldn't control them. But one day, your approached by Ozpin who offers you to attend his school and promises you that he'll help you control your powers. Join (Y/n) as he goes on an adventure to find out why he's different and uncover a bigger world... (Yeah this story combines RWBY and Jak and Daxter....Well, just some parts of the game) All rights go to Rooster teeh and naughty dog
You may also like
Slide 1 of 10
(Volume 2) Mythical Rose (OLD) cover
[Part 1] A New Assassin (An Assassin's Creed x RWBY AU story) cover
The Wilted Rose cover
The Wilted Rose Book 3: Knightfall cover
Why must I suffer? ( A Neglected and abused indra male reader x rwby) cover
THE RONIN cover
Rwby: The Wilted Rose on The Radiant End. Male Dragon Grimm Faunus xSummer rose cover
The Things I've Seen (A RWBY Male OC Insert) cover
My Time Has Passed (RWBY X Legendary Huntsman Male Reader) (OLD) cover
RWBY: Light within Darkness cover

(Volume 2) Mythical Rose (OLD)

18 parts Complete Mature

Team RWBY and Team RCST grow a stronger friendship with each other as the first semester ends, even with a... long awaiting relationship to blossom but only after they've been through a very rough time Also I DO NOT OWN RWBY NOR ANY PICTURES OR MUSIC I'LL USE. KEEP. THAT. IN MIND! RWBY belongs to Rooster Teeth and Monty Oum, May his soul Rest In Peace

More details