•  
  • Browse
    • Browse
    • Paid Stories
    • Historical Fiction
    • Poetry
    • Editor's Picks
    • Horror
    • Romance
    • Wattys 2020
    • Humor
    • Science Fiction
    • Adventure
    • LGBTQ+
    • Short Story
    • Contemporary Lit
    • Mystery
    • Teen Fiction
    • Diverse Lit
    • New Adult
    • Thriller
    • Fanfiction
    • Non-Fiction
    • Werewolf
    • Fantasy
    • Paranormal
    • Wattpad Picks
    • Editors' Choice
    • Available in Bookstores
    • From our Stars
    • Wattpad Studios Hits
    • Community Curator: @grendelthegood
  • Community
    • The Watty Awards
    • Write
      • Create a new storyCreate a new story
      • My Stories
      • Writer Opportunities
      • Writing Contests
    Try Premium
    Log in Sign Up
    The Beginning After The End 2 VF
    FloBio-
  • Reads
    499K
  • Votes
    29.6K
  • Parts
    200
  • Start reading
  • Reads
    499K
  • Votes
    29.6K
  • Parts
    200
  • FloBio-
    Ongoing
    C'est la deuxième partie de l'histoire qui commence au chapitre 53.
        Pour voir le début, allers sur mon profil.
        
        
        
        Le roi Grey a une force, une richesse et un prestige inégalés. Cependant, la solitude persiste étroitement derrière ceux qui ont un grand pouvoir. Sous l'extérieur glamour d'un roi puissant se cache la coquille de l'homme, sans but ni volonté.
        
        Réincarné dans un nouveau monde rempli de magie et de monstres, le roi a une seconde chance de revivre sa vie en tant qu'Arthur Leywin, premier fils d'un modeste couple d'aventuriers pratiquant la magie.
        
        Attention cette œuvre ne m'appartient pas je ne fait que la traduire.
        
        Bonne lecture.
    Public Domain
    • action
    • aventure
    • chapitre
    • fantasy
    • isekai
    • magie
    • manga
    • manhua
    • scan
    • shonen
    • surnaturel
    • trad
    • traduction
    • webtoon
    actionaventurechapitrefantasyisekaimagiemangamanhuascanshonensurnatureltradtraductionwebtoon
    Table of contentsLast updated Mar 23
    • Chapitre 53.1
    • Chapitre 53.2
    • Chapitre 53.3
    • Chapitre 53.4
    • Chapitre 54.1
    • Chapitre 54.2
    • Chapitre 54.3
    • Chapitre 54.4
    • Chapitre 54.5
    • Chapitre 55.1
    • Chapitre 55.2
    • Chapitre 55.3
    • Chapitre 55.4
    • Chapitre 56.1
    • Chapitre 56.2
    • Chapitre 56.3
    • Chapitre 56.4
    • Chapitre 56.5
    • Chapitre 57.1
    • Chapitre 57.2
    • Chapitre 57.3
    • Chapitre 57.4
    • Chapitre 57.5
    • Chapitre 58.1
    • Chapitre 58.2
    • Chapitre 58.3
    • Chapitre 58.4
    • Chapitre 58.5
    • Chapitre 59.1
    • Chapitre 59.2
    • Chapitre 59.3
    • Chapitre 59.4
    • Chapitre 60.1
    • Chapitre 60.2
    • Chapitre 60.3
    • Chapitre 60.4
    • Chapitre 60.5
    • Chapitre 61.1
    • Chapitre 61.2
    • Chapitre 61.3
    • Chapitre 61.4
    • Chapitre 61.5
    • Chapitre 62.1
    • Chapitre 62.2
    • Chapitre 62.3
    • Chapitre 62.4
    • Chapitre 63.1
    • Chapitre 63.2
    • Chapitre 63.3
    • Chapitre 63.4
    • Chapitre 63.5
    • Chapitre 64.1
    • Chapitre 64.2
    • Chapitre 64.3
    • Chapitre 64.4
    • Chapitre 65.1
    • Chapitre 65.2
    • Chapitre 65.3
    • Chapitre 65.4
    • Chapitre 65.5
    • Chapitre 66.1
    • Chapitre 66.2
    • Chapitre 66.3
    • Chapitre 66.4
    • Chapitre 66.5
    • Chapitre 67.1
    • Chapitre 67.2
    • Chapitre 67.3
    • Chapitre 67.4
    • Chapitre 68.1
    • Chapitre 68.2
    • Chapitre 68.3
    • Chapitre 68.4
    • Chapitre 69.1
    • Chapitre 69.2
    • Chapitre 69.3
    • Chapitre 69.4
    • Chapitre 70.1
    • Chapitre 70.2
    • Chapitre 70.3
    • Chapitre 70.4
    • Chapitre 71.1
    • Chapitre 71.2
    • Chapitre 71.3
    • Chapitre 71.4
    • Chapitre 72.1
    • Chapitre 72.2
    • Chapitre 72.3
    • Chapitre 72.4
    • Chapitre 72.5
    • Chapitre 73.1
    • Chapitre 73.2
    • Chapitre 73.3
    • Chapitre 73.4
    • Chapitre 74.1
    • Chapitre 74.2
    • Chapitre 74.3
    • Chapitre 74.4
    • Chapitre 75.1
    • Chapitre 75.2
    • Chapitre 75.3
    • Chapitre 75.4
    • Chapitre 76.1
    • Chapitre 76.2
    • Chapitre 76.3
    • Chapitre 76.4
    • Chapitre 77.1
    • Chapitre 77.2
    • Chapitre 77.3
    • Chapitre 77.4
    • Chapitre 77.5
    • Chapitre 78.1
    • Chapitre 78.2
    • Chapitre 78.3
    • Chapitre 78.4
    • Chapitre 79.1
    • Chapitre 79.2
    • Chapitre 79.3
    • Chapitre 79.4
    • Chapitre 79.5
    • Chapitre 80.1
    • Chapitre 80.2
    • Chapitre 80.3
    • Chapitre 80.4
    • Chapitre 80.5
    • Chapitre 81.1
    • Chapitre 81.2
    • Chapitre 81.3
    • Chapitre 81.4
    • Chapitre 81.5
    • Chapitre 82.1
    • Chapitre 82.2
    • Chapitre 82.3
    • Chapitre 82.4
    • Chapitre 82.5
    • Chapitre 83.1
    • Chapitre 83.2
    • Chapitre 83.3
    • Chapitre 83.4
    • Chapitre 83.5
    • Chapitre 84.1
    • Chapitre 84.2
    • Chapitre 84.3
    • Chapitre 84.4
    • Chapitre 84.5
    • Chapitre 85.1
    • Chapitre 85.2
    • Chapitre 85.3
    • Chapitre 85.4
    • Chapitre 86.1
    • Chapitre 86.2
    • Chapitre 86.3
    • Chapitre 86.4
    • Chapitre 87.1
    • Chapitre 87.2
    • Chapitre 87.3
    • Chapitre 87.4
    • Chapitre 87.5
    • Chapitre 88.1
    • Chapitre 88.2
    • Chapitre 88.3
    • Chapitre 88.4
    • Chapitre 88.5
    • Chapitre 89.1
    • Chapitre 89.2
    • Chapitre 89.3
    • Chapitre 89.4
    • Chapitre 89.5
    • Chapitre 90.1
    • Chapitre 90.2
    • Chapitre 90.3
    • Chapitre 90.4
    • Chapitre 90.5
    • Chapitre 91.1
    • Chapitre 91.2
    • Chapitre 91.3
    • Chapitre 91.4
    • Chapitre 91.5
    • Chapitre 92.1
    • Chapitre 92.2
    • Chapitre 92.3
    • Chapitre 92.4
    • Chapitre 92.5
    • Chapitre 93.1
    • Chapitre 93.2
    • Chapitre 93.3
    • Chapitre 93.4
    • Chapitre 93.5
    • Chapitre 94.1
    • Chapitre 94.2
    • Chapitre 94.3
    • Chapitre 94.4
    • Chapitre 95.1
    • Chapitre 95.2
    • Chapitre 95.3
    • Chapitre 95.4
    • Chapitre 95.5
    • Chapitre 95.6
    • Info
    • Info 2

    Get notified when The Beginning After The End 2 VF is updated

    OR

    If you already have an account,

    By continuing, you agree to Wattpad's Terms of Service and Privacy Policy.
    #19manga
    • Chapitre 53.1
    • Chapitre 53.2
    • Chapitre 53.3
    • Chapitre 53.4
    • Chapitre 54.1
    • Chapitre 54.2
    • Chapitre 54.3
    • Chapitre 54.4
    • Chapitre 54.5
    • Chapitre 55.1
    • Chapitre 55.2
    • Chapitre 55.3
    • Chapitre 55.4
    • Chapitre 56.1
    • Chapitre 56.2
    • Chapitre 56.3
    • Chapitre 56.4
    • Chapitre 56.5
    • Chapitre 57.1
    • Chapitre 57.2
    • Chapitre 57.3
    • Chapitre 57.4
    • Chapitre 57.5
    • Chapitre 58.1
    • Chapitre 58.2
    • Chapitre 58.3
    • Chapitre 58.4
    • Chapitre 58.5
    • Chapitre 59.1
    • Chapitre 59.2
    • Chapitre 59.3
    • Chapitre 59.4
    • Chapitre 60.1
    • Chapitre 60.2
    • Chapitre 60.3
    • Chapitre 60.4
    • Chapitre 60.5
    • Chapitre 61.1
    • Chapitre 61.2
    • Chapitre 61.3
    • Chapitre 61.4
    • Chapitre 61.5
    • Chapitre 62.1
    • Chapitre 62.2
    • Chapitre 62.3
    • Chapitre 62.4
    • Chapitre 63.1
    • Chapitre 63.2
    • Chapitre 63.3
    • Chapitre 63.4
    • Chapitre 63.5
    • Chapitre 64.1
    • Chapitre 64.2
    • Chapitre 64.3
    • Chapitre 64.4
    • Chapitre 65.1
    • Chapitre 65.2
    • Chapitre 65.3
    • Chapitre 65.4
    • Chapitre 65.5
    • Chapitre 66.1
    • Chapitre 66.2
    • Chapitre 66.3
    • Chapitre 66.4
    • Chapitre 66.5
    • Chapitre 67.1
    • Chapitre 67.2
    • Chapitre 67.3
    • Chapitre 67.4
    • Chapitre 68.1
    • Chapitre 68.2
    • Chapitre 68.3
    • Chapitre 68.4
    • Chapitre 69.1
    • Chapitre 69.2
    • Chapitre 69.3
    • Chapitre 69.4
    • Chapitre 70.1
    • Chapitre 70.2
    • Chapitre 70.3
    • Chapitre 70.4
    • Chapitre 71.1
    • Chapitre 71.2
    • Chapitre 71.3
    • Chapitre 71.4
    • Chapitre 72.1
    • Chapitre 72.2
    • Chapitre 72.3
    • Chapitre 72.4
    • Chapitre 72.5
    • Chapitre 73.1
    • Chapitre 73.2
    • Chapitre 73.3
    • Chapitre 73.4
    • Chapitre 74.1
    • Chapitre 74.2
    • Chapitre 74.3
    • Chapitre 74.4
    • Chapitre 75.1
    • Chapitre 75.2
    • Chapitre 75.3
    • Chapitre 75.4
    • Chapitre 76.1
    • Chapitre 76.2
    • Chapitre 76.3
    • Chapitre 76.4
    • Chapitre 77.1
    • Chapitre 77.2
    • Chapitre 77.3
    • Chapitre 77.4
    • Chapitre 77.5
    • Chapitre 78.1
    • Chapitre 78.2
    • Chapitre 78.3
    • Chapitre 78.4
    • Chapitre 79.1
    • Chapitre 79.2
    • Chapitre 79.3
    • Chapitre 79.4
    • Chapitre 79.5
    • Chapitre 80.1
    • Chapitre 80.2
    • Chapitre 80.3
    • Chapitre 80.4
    • Chapitre 80.5
    • Chapitre 81.1
    • Chapitre 81.2
    • Chapitre 81.3
    • Chapitre 81.4
    • Chapitre 81.5
    • Chapitre 82.1
    • Chapitre 82.2
    • Chapitre 82.3
    • Chapitre 82.4
    • Chapitre 82.5
    • Chapitre 83.1
    • Chapitre 83.2
    • Chapitre 83.3
    • Chapitre 83.4
    • Chapitre 83.5
    • Chapitre 84.1
    • Chapitre 84.2
    • Chapitre 84.3
    • Chapitre 84.4
    • Chapitre 84.5
    • Chapitre 85.1
    • Chapitre 85.2
    • Chapitre 85.3
    • Chapitre 85.4
    • Chapitre 86.1
    • Chapitre 86.2
    • Chapitre 86.3
    • Chapitre 86.4
    • Chapitre 87.1
    • Chapitre 87.2
    • Chapitre 87.3
    • Chapitre 87.4
    • Chapitre 87.5
    • Chapitre 88.1
    • Chapitre 88.2
    • Chapitre 88.3
    • Chapitre 88.4
    • Chapitre 88.5
    • Chapitre 89.1
    • Chapitre 89.2
    • Chapitre 89.3
    • Chapitre 89.4
    • Chapitre 89.5
    • Chapitre 90.1
    • Chapitre 90.2
    • Chapitre 90.3
    • Chapitre 90.4
    • Chapitre 90.5
    • Chapitre 91.1
    • Chapitre 91.2
    • Chapitre 91.3
    • Chapitre 91.4
    • Chapitre 91.5
    • Chapitre 92.1
    • Chapitre 92.2
    • Chapitre 92.3
    • Chapitre 92.4
    • Chapitre 92.5
    • Chapitre 93.1
    • Chapitre 93.2
    • Chapitre 93.3
    • Chapitre 93.4
    • Chapitre 93.5
    • Chapitre 94.1
    • Chapitre 94.2
    • Chapitre 94.3
    • Chapitre 94.4
    • Chapitre 95.1
    • Chapitre 95.2
    • Chapitre 95.3
    • Chapitre 95.4
    • Chapitre 95.5
    • Chapitre 95.6
    • Info
    • Info 2
    Report this story
    You may also like
    I Became the Wife of a Monstrous Crown Prince VF by
    I Became the Wife of a Monstrous Crown Princ...
    42 parts
    Ongoing
    Elle a transmigré dans le corps d'Ancia, l'épouse actuelle du monstrueux prince héritier, Blake, da...
    Diphylleia's Plan to Coup  by
    Diphylleia's Plan to Coup
    24 parts
    Ongoing
    Thao Vy- une jeune fille de 18 ans au printemps de sa jeunesse, la précieuse fille d'un propriétair...
    BOTV  by
    BOTV
    85 parts
    Ongoing
    Peu de temps après m'être réveillé en tant que méchante, j'ai vu mon fiancé, le rôle principal du r...
    The Song of Theodor by
    The Song of Theodor
    6 parts
    Ongoing
    Durant leur enfance, Sienna, princesse de l'empire de l'ouest au caractère fort, ainsi que Latio, p...
    My Sister Picked Up The Male Lead by
    My Sister Picked Up The Male Lead
    6 parts
    Ongoing
    Le personnage principal se réincarne dans un personnage secondaire d'un roman qu'elle a déjà lu. El...
     Come out, Romeo  by
    Come out, Romeo
    10 parts
    Ongoing
    Roméo Montague, un garçon jeté dans le grenier avec dégoût après un accident il y a cinq ans. Bien...
    I Raised The Beast Well by
    I Raised The Beast Well
    39 parts
    Ongoing
    Blondina, une princesse qui avait du sang de roturière, vivait tranquillement dans un palais séparé...
    Beware of the brothers by
    Beware of the brothers
    65 parts
    Ongoing
    ⚠️petite info je ne suis pas l'auteur de ce webtoon je ne fait que je traduire et espère qu'il plai...
    Nom: I Was Born as the Demon Lord's by
    Nom: I Was Born as the Demon Lord's
    12 parts
    Ongoing
    Synopsis : Joara a vécu et est morte misérablement, mais à la fin de sa vie, elle a réalisé qu'elle...
    WMMAP by
    WMMAP
    25 parts
    Ongoing
    Quand j'ai ouvert les yeux , j'étais devenue une princesse ! mais de tout les personnages de ce rom...
    You may also like
    • I Became the Wife of a Monstrous Crown Prince VF cover
      amitier
    • Diphylleia's Plan to Coup  cover
      fantastique
    • BOTV  cover
      ado
    • The Song of Theodor cover
      amour
    • My Sister Picked Up The Male Lead cover
      manhwa
    •  Come out, Romeo  cover
      action
    • I Raised The Beast Well cover
      amitié
    • Beware of the brothers cover
      comédie
    • Nom: I Was Born as the Demon Lord's cover
      aventure
    • WMMAP cover
      mahnwa

    I Became the Wife of a Monstrous Crown Prince VF

    42 parts
    Ongoing

    Elle a transmigré dans le corps d'Ancia, l'épouse actuelle du monstrueux prince héritier, Blake, dans un roman d'amour R-19. Dans l'histoire originale, Ancia s'est suicidée le jour de leur mariage, l...

    Start reading
    • Paid Stories
    • Try Premium
    • Get the App
    • Language
    • Writers
    • |
    • Business
    • Jobs
    • Press
    • Terms
    • Privacy
    • Accessibility
    • Help
    • © 2021 Wattpad