Story cover for New Save File (Sequel to Not So Virtual Reality) by books_are_my_tardis
New Save File (Sequel to Not So Virtual Reality)
books_are_my_tardis
  • WpView
    MGA BUMASA 2,400
  • WpVote
    Mga Boto 122
  • WpPart
    Mga Parte 8
  • WpHistory
    Oras 50m
  • WpView
    MGA BUMASA 2,400
  • WpVote
    Mga Boto 122
  • WpPart
    Mga Parte 8
  • WpHistory
    Oras 50m
books_are_my_tardis
Kumpleto, Unang na-publish Oct 16, 2017
amazingphilcinnamontoastkendanielhowelljacksepticeyemarkipliermatthiaspewdiepie
Sequel to Not So Virtual Reality (I highly suggest reading that first before this one)
All Rights Reserved
amazingphilcinnamontoastkendanielhowelljacksepticeyemarkipliermatthiaspewdiepie
Table of contents

8 parte

Sign up to add New Save File (Sequel to Not So Virtual Reality) to your library and receive updates
o
#403matthias
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
~~YoutubersxChild!reader imagines~~ ni CrazyShyGirlie
24 mga parte Kumpleto
This book is what the titel says ;) Because youtube = life!!!!! p.s. I'm not English so if there is bad grammar you know why! And this is my first book so maybe that explains why it's shitty XD Edit: please note that I wrote this years ago when I was barely a teenager
Her Scar | Jacksepticeye/Antisepticeye X Reader ni AgenderBabyMuffin
12 parte Kumpleto Mature
Anti, he always lived in Seán's head. He would take control and do awful things... The police finally realized a serial killer was slitting people's throats and began to investigate. But eventually, one survived. She was unconscious for quite some time until her throat healed, leaving her with a very obvious scar across her neck, forever marking her as the one that got away. Anti was furious and vowed to himself that by any means, he would finish the job... [CONTAINS STRONG LANGUAGE AND MATURE THEMES] UPDATES EVERY FRIDAY 12-1AM EST NONE OF THE IMAGES IN THIS BOOK BELONG TO ME. ALL RIGHTS GO TO CURRENT OWNERS
Markiplier Imagines ni AbiEvans
64 mga parte Kumpleto
Markiplier x Reader imagines and maybe one or two chapters of Septiplier just because I can't resist. Some fluffy ones, some funny ones. Some weird ones and some cute ones. Requests are open. Hope you enjoy it.
Encore (Book Four of Test the Limits Series) ni books_are_my_tardis
13 parte Kumpleto
Third book in the Test The Limits Series, I'd suggest reading the other two first!
Ask or Dare #2! ni liz91200
57 parte Kumpleto Mature
My 2nd Ask or Dare book! If you haven't read the first one, you'll miss a bit of their backgrounds, but anyways, I hope you enjoy!
Savior ni IceQueen713
18 parte Kumpleto Mature
: Book 1 : :TRIGGER WARNING:PLEASE READ: trigger warning I will not give any further warning it ruins the atmosphere this story will have topics for a mature audience such as possible lemon rape death slight Gore cursing and is recommended for 18+ or you may read at your own risk. Disclaimer: I Don't own Markiplier/Darkiplier Jacksepticeye/Antisepticeye and NONE of the Artwork or Photo's are Mine they are off of a Public Domain such as Twitter/Facebook. Thank You ♡
Fear the Dark Side of Youtube (Editing) ni Annabeth60510
23 parte Kumpleto
Everyone has a dark side, but some are stronger than most. When you devote your life to making people happy it comes with a price. Jack is having an ordinary day of recording, when everything starts going horribly. Sequal: The Rise of Jacksepticeye - Book 2 Cover: By Me
Latch ni Xscapee
33 parte Kumpleto
(Sequal in progress) (Y/n) is stuck in a sticky situation with some people she barely knows. From sandy barren wastelands to rocky hills (Y/n) is stuck in the constructs of her own mind. Will the Youtubers secret destroy the world? Or will they overcome their demons in the end? Whatever the case, enjoy the show... (Antisepticeye/Jacksepticeye x Reader) #1 (#jacksepticeyefanfic) #1 (#evilyoutubers)
I Don't Want to Hurt You! (Antisepticeye/Jacksepticeye X Reader) [ BEING EDITED] ni odd_nonsense
48 parte Kumpleto Mature
Y/N, or you, meet the JACKSEPTICEYE while saving him from your roommate's boyfriend. However, he acts a lot differently than on camera. You notice strange stomach cramps and... his eyes change from blue to pure black. When you find out about his demon, danger plagues your life. Nightmare is out for revenge, and you are directly in the crossfire. Will both of you make it out without being hurt? ( Gender neutral story using they/them. Also: Y/N means your name.) ( COMPLETED.) ( SEQUEL: I DON'T WANT TO BE HURT ) ( ALL CHARACTERS IN THIS ARE MINE FOR THE EXCEPTION OF SEAN [ Of course ] SO PLEASE MESSAGE ME IF YOU WANT TO TAKE MY CHARACTER AND PUT THEM INTO YOUR BOOK. Thank you!)
Magugustuhan mo rin ang
Slide 1 of 9
~~YoutubersxChild!reader imagines~~ cover
Her Scar | Jacksepticeye/Antisepticeye X Reader cover
Markiplier Imagines cover
Encore (Book Four of Test the Limits Series) cover
Ask or Dare #2! cover
Savior cover
Fear the Dark Side of Youtube (Editing) cover
Latch cover
I Don't Want to Hurt You! (Antisepticeye/Jacksepticeye X Reader) [ BEING EDITED] cover

~~YoutubersxChild!reader imagines~~

24 mga parte Kumpleto

This book is what the titel says ;) Because youtube = life!!!!! p.s. I'm not English so if there is bad grammar you know why! And this is my first book so maybe that explains why it's shitty XD Edit: please note that I wrote this years ago when I was barely a teenager

Karagdagang detalye